DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twit and CG14401

DIOPT Version :9

Sequence 1:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001246115.1 Gene:CG14401 / 35358 FlyBaseID:FBgn0032900 Length:198 Species:Drosophila melanogaster


Alignment Length:137 Identity:37/137 - (27%)
Similarity:55/137 - (40%) Gaps:27/137 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQCWHCSS-DTIGAEDFCDVTFQEDNIPT---DLIKERNINLLRSCNGTINSDHERAVCRKTVEE 94
            :.|:.|.| :..|    |...|..|:|.|   |::..     :||...       .|.|.....|
  Fly    75 ITCYECDSVNNPG----CGERFVGDDISTTDCDVVAN-----MRSLGA-------EATCLTKYHE 123

  Fly    95 N--NGKLITKRFCYYTNKSDPVELCNITSPEKNV---RRIFCEDCLTDRCNGALAGASILEMLLL 154
            .  ......:|.||:.:.| |:.:.....|:..|   ..:.|..|.||.||.| ||.|.|.:::.
  Fly   124 GMPGDTRFVRRSCYFGDAS-PIGVSCDDGPDPVVPFMNFLGCTLCDTDLCNAA-AGLSTLPLVIA 186

  Fly   155 LPIAGLI 161
            |.|.||:
  Fly   187 LSILGLL 193



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.