DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twit and CG9338

DIOPT Version :10

Sequence 1:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_610071.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster


Alignment Length:139 Identity:36/139 - (25%)
Similarity:53/139 - (38%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQCWHCSSDTIGAEDFCDVTFQED-NIPTDLIKE------RNINLLRSCNGTINSDHERAVCRKT 91
            ::|:.|.|.|   ...|....:.| ::..|..|.      :|...:|:..|          |.|.
  Fly    24 IKCYQCDSLT---NSECGKDIKSDSSLVLDCTKMAPPRFLQNFFPVRNATG----------CMKQ 75

  Fly    92 VEENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRIF-CEDCLTDRCNGALAGASILEMLLLL 155
            ..:..|.....|.||:.|.:|....|. |.|...:.::. ||.|..|.|||..:         |.
  Fly    76 TIDIPGNPQIVRSCYFGNIADTKVGCQ-TDPSLTINKLLSCEVCTEDECNGTSS---------LA 130

  Fly   156 PIAGLIQQF 164
            ||||:|..|
  Fly   131 PIAGVILLF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twitNP_610067.1 TFP_LU_ECD_Twit 33..142 CDD:467122 28/115 (24%)
CG9338NP_610071.1 TFP 23..125 CDD:480272 27/114 (24%)

Return to query results.
Submit another query.