DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twit and CG9336

DIOPT Version :9

Sequence 1:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_610069.2 Gene:CG9336 / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster


Alignment Length:141 Identity:35/141 - (24%)
Similarity:56/141 - (39%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQCWHCSSDTIGAEDFCDVTFQEDNI----------PTDLIKERNINLLRSCNGTINSDHERAVC 88
            ::|:.|.|.|:..   |.:.|:.|..          |..|   :|...||:..|.:         
  Fly    24 IKCYQCESLTMPK---CGLKFEADETLLLDCSRIGPPRYL---QNFFPLRNATGCM--------- 73

  Fly    89 RKTVEENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRIFCEDCLTDRCNGALAGASILEMLL 153
            :||:|...|.....|.||:.:.::....|........|:::.|:.|..|.|||:.:         
  Fly    74 KKTLESVAGHPQIVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCTKDECNGSSS--------- 129

  Fly   154 LLPIAGLIQQF 164
            |.||||.|..|
  Fly   130 LAPIAGAILLF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twitNP_610067.1 None
CG9336NP_610069.2 QVR 24..125 CDD:407231 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147170at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.