DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twit and CG31676

DIOPT Version :9

Sequence 1:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001286113.1 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster


Alignment Length:151 Identity:46/151 - (30%)
Similarity:77/151 - (50%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAGLFLLANAWH-ITAINEQHQKHHLQCWHCSSDTIGAEDFCDVTFQEDNIPTDLIKERNINLLR 73
            |.|||.|...:: .:|:        |:||.||:|....| ||:..|    :|..:.:::......
  Fly    10 LLGLFSLLMVFNTASAV--------LRCWRCSTDVSNGE-FCNDPF----MPETISEQQRYWSYV 61

  Fly    74 SCNGTI--NSDHERAVCRKTVEENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRIFCEDCLT 136
            :|..::  .|.:.|.||:|.|:|..||.:..|.|:|.:..|..:.|........::.::|..|.|
  Fly    62 NCTYSVGAKSVNARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTT 126

  Fly   137 DRCNGALAGASILEMLLLLPI 157
            |.|||| :||:...:||:||:
  Fly   127 DGCNGA-SGATPRVLLLMLPL 146



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C6C8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.