| Sequence 1: | NP_610067.1 | Gene: | twit / 35353 | FlyBaseID: | FBgn0032895 | Length: | 166 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001368205.1 | Gene: | K11H12.6 / 187313 | WormBaseID: | WBGene00019662 | Length: | 134 | Species: | Caenorhabditis elegans |
| Alignment Length: | 132 | Identity: | 31/132 - (23%) |
|---|---|---|---|
| Similarity: | 49/132 - (37%) | Gaps: | 26/132 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 LQCWHCSSDTIGAEDFCDVTFQEDNIPTDLIKERNINLLRSCNGTINSDHERAVCRKTVEENNGK 98
Fly 99 LITKRFCYYTNKSDPVELCNITSPEKNVRR----IFCEDCLTDRCNGA------LAGASILEMLL 153
Fly 154 LL 155 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||