DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and CG9338

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_610071.1 Gene:CG9338 / 35357 FlyBaseID:FBgn0032899 Length:147 Species:Drosophila melanogaster


Alignment Length:151 Identity:43/151 - (28%)
Similarity:69/151 - (45%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLGLFSLLMVFNTASAVLRCWRCSTDVSNGEFCNDPFMPETISEQQRYWSYVNCTYSVGAKSV- 72
            ::|.|..|..|..|..|: :|::|.: ::|.|...|.....::        .::||.....:.: 
  Fly     7 MILALTVLATVACTGYAI-KCYQCDS-LTNSECGKDIKSDSSL--------VLDCTKMAPPRFLQ 61

  Fly    73 NARPV-----CKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTTDGCNGA 132
            |..||     |.|...::.|...|.|||::.::.|:...|..|.:.:..|.:.|..||.|.|||.
  Fly    62 NFFPVRNATGCMKQTIDIPGNPQIVRSCYFGNIADTKVGCQTDPSLTINKLLSCEVCTEDECNGT 126

  Fly   133 SGATP--RVLLLMLPL--LLA 149
            |...|  .|:||...|  |||
  Fly   127 SSLAPIAGVILLFFGLARLLA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 27/110 (25%)
CG9338NP_610071.1 TFP 23..125 CDD:480272 27/111 (24%)

Return to query results.
Submit another query.