DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and bero

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_610069.2 Gene:bero / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster


Alignment Length:65 Identity:23/65 - (35%)
Similarity:36/65 - (55%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTTDGCNGASGATP 137
            ||....||.::.|.|...|.|||::.|:::....|.:|.:..::|.:.|..||.|.|||:|...|
  Fly    68 NATGCMKKTLESVAGHPQIVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCTKDECNGSSSLAP 132

  Fly   138  137
              Fly   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 20/58 (34%)
beroNP_610069.2 TFP 23..127 CDD:480272 20/58 (34%)

Return to query results.
Submit another query.