DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and twit

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster


Alignment Length:151 Identity:46/151 - (30%)
Similarity:77/151 - (50%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLGLFSLLMVFNTASAV--------LRCWRCSTDVSNGE-FCNDPF----MPETISEQQRYWSYV 61
            |.|||.|...:: .:|:        |:||.||:|....| ||:..|    :|..:.:::......
  Fly    10 LAGLFLLANAWH-ITAINEQHQKHHLQCWHCSSDTIGAEDFCDVTFQEDNIPTDLIKERNINLLR 73

  Fly    62 NCTYSVGAKSVNARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTT 126
            :|..::  .|.:.|.||:|.|:|..||.:..|.|:|.:..|..:.|........::.::|..|.|
  Fly    74 SCNGTI--NSDHERAVCRKTVEENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRIFCEDCLT 136

  Fly   127 DGCNGA-SGATPRVLLLMLPL 146
            |.|||| :||:...:||:||:
  Fly   137 DRCNGALAGASILEMLLLLPI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 32/109 (29%)
twitNP_610067.1 TFP_LU_ECD_Twit 33..142 CDD:467122 32/110 (29%)

Return to query results.
Submit another query.