DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and CG6583

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_609556.2 Gene:CG6583 / 34645 FlyBaseID:FBgn0032420 Length:154 Species:Drosophila melanogaster


Alignment Length:186 Identity:44/186 - (23%)
Similarity:61/186 - (32%) Gaps:91/186 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLGLFSLLMVFNTASAVLRCWRCSTDV------SNGEF------------CN--DPFMPETISE 53
            ||...|.||.:....|..:||::||:|.      |.|.:            ||  :..||.:.  
  Fly     4 LLRCTFLLLTLAICGSWAIRCYQCSSDQDRKGHDSCGAYKRFNRTEHISIECNSDESHMPGSF-- 66

  Fly    54 QQRYWSYVNCTYSVGAKSVNARPVCKKLVQEVYGKR----------VISRSCFYEDMDDSADKCA 108
                                    |.|:||:  |.|          ||.|             ||
  Fly    67 ------------------------CMKVVQQ--GPRGFIWDGRWRQVIRR-------------CA 92

  Fly   109 NDQTSS---------YIKTVYCRT--CTTDGCNGAS-----GATPRVLLLMLPLLL 148
            :...:.         |...||...  |::|.|||:|     |:    |.|:|.|||
  Fly    93 SVSDTGVVGVCNWGVYENGVYWEECYCSSDSCNGSSLVQMHGS----LQLLLGLLL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 29/145 (20%)
CG6583NP_609556.2 QVR 22..125 CDD:435716 27/143 (19%)

Return to query results.
Submit another query.