DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and CG14275

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_609211.1 Gene:CG14275 / 34144 FlyBaseID:FBgn0032022 Length:148 Species:Drosophila melanogaster


Alignment Length:168 Identity:49/168 - (29%)
Similarity:69/168 - (41%) Gaps:51/168 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLLLGLFSLLMVFNTASAVLRCWRCSTDVSNGEFC-----NDPFMPETISEQQRYWSYV-NCTYS 66
            ||:|.. :||    |.:|: ||.:|::  .:.|.|     |.|       ..||...|: :|...
  Fly    11 CLVLAA-NLL----TVNAI-RCHQCNS--HDNEDCGGLVVNTP-------RAQRDNQYLTDCVPP 60

  Fly    67 VGAKSVNARPVCKKLV--QEVYGKRVISRSC-FYEDMDDSADKCANDQTSSYIKTVYCRTCTTDG 128
            .|..:     .|:|.|  .|...:|.|.||| |..:...:|  |.......| |.:.| ||..:|
  Fly    61 SGEVA-----FCRKTVINFEQNDERRIERSCGFIPEKIQNA--CFTADNEGY-KQIIC-TCPDEG 116

  Fly   129 CNGASGATPRVLLL------------MLPLLLAAAFRH 154
            |||||.      ||            ::.|.||:..||
  Fly   117 CNGASS------LLGVRQLGYSLVGSVVSLALASMLRH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 32/113 (28%)
CG14275NP_609211.1 QVR 24..118 CDD:435716 30/112 (27%)

Return to query results.
Submit another query.