DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and bou

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_572373.1 Gene:bou / 31644 FlyBaseID:FBgn0261284 Length:149 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:53/130 - (40%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STGCLLLGLFSLLMVFNTASAVLRCWRCSTDVSNGEF-CNDPFMPETISEQQRYWSYVNCTYSVG 68
            |:..|::.|.||.||..:.   :.|:.|.|..:...| |.:.|....|.:.|..    ||:    
  Fly    13 SSLALVVLLMSLQMVMVSG---IECYVCDTSDTEHPFQCGEWFERYDIPDIQPQ----NCS---- 66

  Fly    69 AKSVNARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCAN-DQTSSYIKTVYCRTCTTDGCNGA 132
              ||:....|.|.|....|.....|.|..:||.:..|...| .....|...:|  ||.|||||.|
  Fly    67 --SVHGAQFCVKHVGRFEGGIGAKRFCSSKDMGNYCDYVRNKGDRMDYRSCIY--TCDTDGCNAA 127

  Fly   133  132
              Fly   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 31/106 (29%)
bouNP_572373.1 TFP_LU_ECD_Bou 32..127 CDD:467119 31/106 (29%)

Return to query results.
Submit another query.