DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31676 and crok

DIOPT Version :10

Sequence 1:NP_652593.3 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_314738.3 Gene:crok / 1275490 VectorBaseID:AGAMI1_008169 Length:158 Species:Anopheles gambiae


Alignment Length:148 Identity:41/148 - (27%)
Similarity:62/148 - (41%) Gaps:25/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFSLLMVFNTASAV-LRCWRCSTDVSNGEFCNDPFMPETIS-------EQQRYWSYVNCTYSVGA 69
            |..:|:.|.....: ::||.|.:|  :...|.|||...|:|       |::.:......|     
Mosquito    13 LVVVLLSFGVQKGLAIKCWECRSD--SDPKCADPFDNSTLSITDCKQVERKEHLPEAQAT----- 70

  Fly    70 KSVNARPVCKKLVQEVYGKRVISRSC-FYEDMDDSADK--CANDQTSSYIKTVYCRTCTTDGCNG 131
                   :|:|:.|:|.|:....||| |..:.....|:  |.....:..|...||...:.||||.
Mosquito    71 -------MCRKIRQKVNGEWRYFRSCAFMGEPGIEGDERFCLMRSGTYNIFMEYCTCNSKDGCNA 128

  Fly   132 ASGATPRVLLLMLPLLLA 149
            .|...|..|||:...|||
Mosquito   129 GSLHGPAGLLLLGASLLA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31676NP_652593.3 TFP_LU_ECD_Twit 27..132 CDD:467122 30/114 (26%)
crokXP_314738.3 TFP_LU_ECD_Crok 27..128 CDD:467121 29/114 (25%)

Return to query results.
Submit another query.