DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and FDH1

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_015033.1 Gene:FDH1 / 854570 SGDID:S000005915 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:65/273 - (23%)
Similarity:113/273 - (41%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AAGSQLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHFHAGRTEIE 134
            |....|:...|...|.|.||:....:|.|.:....|....:||:..:..::...|:::.|..:..
Yeast    84 AEAPNLKLCVTAGVGSDHVDLEAANERKITVTEVTGSNVVSVAEHVMATILVLIRNYNGGHQQAI 148

  Fly   135 RSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYH----------TRTRKE 189
            ..:|.|..:. ....::.|.:|...|.|.|...:.:||..::..|::|:          .|..:.
Yeast   149 NGEWDIAGVA-KNEYDLEDKIISTVGAGRIGYRVLERLVAFNPKKLLYYDYQELPAEAINRLNEA 212

  Fly   190 ND-----GDFKAEHVSFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLVN 249
            :.     ||........|.::.:||.:.:..||..::|..||.|..:.||..:..||.|||.:..
Yeast   213 SKLFNGRGDIVQRVEKLEDMVAQSDVVTINCPLHKDSRGLFNKKLISHMKDGAYLVNTARGAICV 277

  Fly   250 QTDLHDALTNGTISAAGLDVTTPEPLPANSPLLNVPNCVILPHMGTQTMKTTIEMGLLAA----- 309
            ..|:.:|:.:|.::..|.||...:|.|.:.|...:.|   ..|:| ..|...|....|.|     
Yeast   278 AEDVAEAVKSGKLAGYGGDVWDKQPAPKDHPWRTMDN---KDHVG-NAMTVHISGTSLDAQKRYA 338

  Fly   310 ---NNILNAIEGK 319
               .||||:...|
Yeast   339 QGVKNILNSYFSK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 65/273 (24%)
GDH 9..318 CDD:240626 64/270 (24%)
FDH1NP_015033.1 FDH 4..371 CDD:240627 65/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53501
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.