DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and AT1G72190

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_177364.2 Gene:AT1G72190 / 843551 AraportID:AT1G72190 Length:373 Species:Arabidopsis thaliana


Alignment Length:308 Identity:80/308 - (25%)
Similarity:138/308 - (44%) Gaps:41/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EILQKVP--GVDAIYW--------------AHYQPLNAGILDAAGSQLRCVSTMSSGIDFVDIPE 92
            |.||..|  .||.:::              |....:::.::..| |.::.:.....|:|.|||..
plant    70 EYLQPYPFIKVDVVHYRDVPEVIKNYHICVAMTMQMDSNVISRA-SNIKLIMQYGVGLDGVDIDA 133

  Fly    93 FQKRGIPLGHTPGV-VKNAV--ADLAIGLMIAAGRHFHAGRTEIERSQWKIEQINWMMGQEIRDS 154
            ..|.||.:...|.. ..||.  :::||.||:...:         ::::.:|...|.::|:...|:
plant   134 ATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLK---------KQNEMQISLRNRLLGEPTGDT 189

  Fly   155 VIG----FFGFGGISQAIAKRLQCWDVAKIIYHTR----TRKENDG---DFKAEHVSFEQLLQES 208
            ::|    ..|:|.|...:||||:.:. :::|...|    :..::|.   |.|..|........::
plant   190 LLGKTVFILGYGNIGIELAKRLKPFG-SRVIATKRFWPASIVDSDSRLVDEKGSHEDIYTFAGKA 253

  Fly   209 DFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLVNQTDLHDALTNGTISAAGLDVTTPE 273
            |.:||...|..||.|..|.:....||:.::.||:|||||:|.......|.:|.:...|:||...|
plant   254 DIVVVCLRLNKETAEIVNKEFICSMKKGALLVNIARGGLINYESAFQNLESGHLGGLGIDVAWSE 318

  Fly   274 PLPANSPLLNVPNCVILPHMGTQTMKTTIEMGLLAANNILNAIEGKPM 321
            |...|.|:|...|.:|.||:...|..:...|..:..:..|...||.|:
plant   319 PFDPNDPILKFKNVIITPHVAGVTEYSYRSMAKIVGDLALQLHEGLPL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 79/305 (26%)
GDH 9..318 CDD:240626 77/303 (25%)
AT1G72190NP_177364.2 PLN02928 34..373 CDD:215501 80/308 (26%)
SerA 80..353 CDD:223189 72/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378766at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.