DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and AT5G28310

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_198183.1 Gene:AT5G28310 / 832915 AraportID:AT5G28310 Length:233 Species:Arabidopsis thaliana


Alignment Length:171 Identity:36/171 - (21%)
Similarity:61/171 - (35%) Gaps:58/171 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 IGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDGDFKAEHVSFEQLLQESDFLVVAAPLTNE 220
            ||..|.|.|...:|.||:.:. .:|.|.:|.||    .:...:..:..:                
plant   117 IGIVGLGSIGSKVATRLKAFG-CQISYSSRNRK----PYAVPYHYYMDI---------------- 160

  Fly   221 TREKFNGKAFNLMKRSSVFVNVARGGLVNQTDLHDALTNGTISAAGLDVTTPEPLPANSP--LLN 283
              |:.:|          |.||||.|.::::.::                       :|.|  |..
plant   161 --EEMHG----------VIVNVALGAIIDEEEM-----------------------SNVPKELFE 190

  Fly   284 VPNCVILPHMGTQTMKTTIEMGLLAANNILNAIEGKPMIRP 324
            :.|.|..||....|::...|:|.:...||......||::.|
plant   191 LDNVVFSPHCAFMTLEGLEELGKVVVGNIEAFFSNKPLLTP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 33/165 (20%)
GDH 9..318 CDD:240626 33/163 (20%)
AT5G28310NP_198183.1 NADB_Rossmann <115..224 CDD:304358 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378766at2759
OrthoFinder 1 1.000 - - FOG0000836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X646
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.