DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and grhpr.2

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001007896.1 Gene:grhpr.2 / 493279 XenbaseID:XB-GENE-5815683 Length:328 Species:Xenopus tropicalis


Alignment Length:333 Identity:125/333 - (37%)
Similarity:183/333 - (54%) Gaps:23/333 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRATRAFKVLISHPNVPAPALELLRSRGAETIICQS---VPPSRDEILQKVPGVDAIYWAHYQP 62
            |....:..||.::. .:|....:||...|.......|   :|  |:|:|:.:.|...:.......
 Frog     1 MEGTQQHMKVFVTR-RIPPEGQKLLSQAGINVQQWDSDEVIP--REELLKGIEGAHGLLCLLTDT 62

  Fly    63 LNAGILDAAGSQLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHFH 127
            ::.|::||||..|:.:||:|.|.|.:...|.::|||.:|.||.|..:|.|:||:.|::...|...
 Frog    63 IDKGVMDAAGPNLKVISTLSVGFDHLATDEIKRRGIKVGATPDVSTDATAELAVTLLLTTCRRLP 127

  Fly   128 AGRTEIERSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDG 192
            ....|:....||.....||.|..:.||.:|..|.|.|..|||:||:.:.|.:.:|        .|
 Frog   128 EAIEEVRNGGWKTWAPMWMCGYGLSDSTVGVIGLGRIGLAIAQRLKPFGVKRFLY--------TG 184

  Fly   193 ---------DFKAEHVSFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLV 248
                     :.|||.||.|:|.:||||::|:.|||.||....|...|..||:::||:|.:||.:|
 Frog   185 IPPCLKSVEELKAELVSTEKLAEESDFVLVSCPLTPETVGLCNKDFFQRMKKTAVFINTSRGPVV 249

  Fly   249 NQTDLHDALTNGTISAAGLDVTTPEPLPANSPLLNVPNCVILPHMGTQTMKTTIEMGLLAANNIL 313
            ||.||:.||.:|.|:|||||||||||||.:.|||.:.|||||||:|:.|......|.:||..|:|
 Frog   250 NQEDLYQALVSGQIAAAGLDVTTPEPLPTDHPLLTLKNCVILPHIGSATHGARNAMSVLAVKNLL 314

  Fly   314 NAIEGKPM 321
            ..:.|:.|
 Frog   315 KGLAGEVM 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 123/322 (38%)
GDH 9..318 CDD:240626 122/320 (38%)
grhpr.2NP_001007896.1 GDH 8..319 CDD:240626 122/321 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378766at2759
OrthoFinder 1 1.000 - - FOG0000836
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X646
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.