DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and CtBP

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001262522.1 Gene:CtBP / 41602 FlyBaseID:FBgn0020496 Length:481 Species:Drosophila melanogaster


Alignment Length:327 Identity:89/327 - (27%)
Similarity:125/327 - (38%) Gaps:44/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PALELLRSRG-----------AETIICQSVPPSRDEILQKV--PGVDAIYWAHYQPLNAGILDAA 71
            |.:.||..|.           |....|.:  .|..||.:||  ..|.|:.| |...|....|:..
  Fly    28 PLVALLDGRDCSIEMPILKDVATVAFCDA--QSTSEIHEKVLNEAVGALMW-HTIILTKEDLEKF 89

  Fly    72 GSQLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHFHAGRTEIERS 136
             ..||.:..:.||.|.:|:....:.||.:.:.||.....|||..:.|::...|          |:
  Fly    90 -KALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYR----------RT 143

  Fly   137 QW---KIEQINWMMGQE-----------IRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTR 187
            .|   .:.:.....|.|           ||...:|..|.|.|..|:|.|.:.:....|.|.....
  Fly   144 YWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLP 208

  Fly   188 KENDGDFKAEHV-SFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLVNQT 251
            ...|.......| :.:.||.:||.:.:...|........|......|:..:..||.||||||:..
  Fly   209 DGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDE 273

  Fly   252 DLHDALTNGTISAAGLDVTTPEPLPANSPLLNVPNCVILPHMGTQTMKTTIEMGLLAANNILNAI 316
            .|..||..|.|.||.|||...||.  |..|.:.||.:..||....:..:..|:..:||..|..||
  Fly   274 TLALALKQGRIRAAALDVHENEPY--NGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 336

  Fly   317 EG 318
            .|
  Fly   337 VG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 89/327 (27%)
GDH 9..318 CDD:240626 88/325 (27%)
CtBPNP_001262522.1 CtBP_dh 28..342 CDD:240624 89/327 (27%)
LdhA 45..351 CDD:223980 85/310 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.