DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and SPAC186.02c

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_595020.1 Gene:SPAC186.02c / 2542495 PomBaseID:SPAC186.02c Length:332 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:68/276 - (24%)
Similarity:118/276 - (42%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LNAGILDA-AGSQLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHF 126
            ::|..|.| |.:.::.|:....|.:.|::....:..|.:.|.|.....||::..:||:::..|..
pombe    56 VDADTLKALAENGVKLVALRCGGYNNVNLKAASEYKITVVHVPSYSPFAVSEFTVGLLLSLNRKI 120

  Fly   127 HAGRTEIERSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCW------DVAKIIYHTR 185
            |.....:....:.|.   .::|.:|....:|..|.|.|...:||   |:      ||.....:..
pombe   121 HRAYVRVREDDFNIV---GLLGCDIHGKTVGVIGTGKIGSNVAK---CFKMGFGCDVLAYDINPD 179

  Fly   186 TRKENDGDFKAEHVSFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLVNQ 250
            .:.||.|   .:.|...::|:::|||.:..|||..|....|..:..|||:....||.:||||::.
pombe   180 KKLENYG---VQFVEQNEVLKKADFLCLHCPLTPSTTHIVNSDSLALMKKGVTIVNTSRGGLIDT 241

  Fly   251 TDLHDALTNGTISAAGLDVTTPEPLPAN----------------SPLLNVPNCVILPHMGTQTMK 299
            ..|.||:.:|.:....:||...|   .|                ..|:|.||.::..|   |...
pombe   242 KALVDAIDSGQVGGCAIDVYEGE---RNLFYKDLSNEVIKDSTFQRLVNFPNVLVTSH---QAFF 300

  Fly   300 TTIEMGLLAANNILNA 315
            ||..:..:|...:.:|
pombe   301 TTEALCSIAHTTLKSA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 68/276 (25%)
GDH 9..318 CDD:240626 68/276 (25%)
SPAC186.02cNP_595020.1 LdhA 1..322 CDD:223980 68/276 (25%)
LDH_like_2 1..319 CDD:240659 68/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53501
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.