DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31673 and CTBP2

DIOPT Version :9

Sequence 1:NP_724294.1 Gene:CG31673 / 35348 FlyBaseID:FBgn0051673 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_073713.2 Gene:CTBP2 / 1488 HGNCID:2495 Length:985 Species:Homo sapiens


Alignment Length:338 Identity:92/338 - (27%)
Similarity:136/338 - (40%) Gaps:43/338 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LISHPNVPAPALELLRSRG-----------AETIICQSVPPSRDEILQKV--PGVDAIYWAHYQP 62
            :::.|..|.|.:.||..|.           |....|.:  .|..||.:||  ..|.|:.: |...
Human   565 IMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDA--QSTQEIHEKVLNEAVGAMMY-HTIT 626

  Fly    63 LNAGILDAAGSQLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHFH 127
            |....|:.. ..||.:..:.||.|.|||....:.||.:.:.|.......||..|..::...|   
Human   627 LTREDLEKF-KALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYR--- 687

  Fly   128 AGRTEIERSQW------------KIEQINWMM--GQEIRDSVIGFFGFGGISQAIAKRLQCWDVA 178
                   |:.|            .:|||..:.  ...||...:|..|||...||:|.|.:.:..:
Human   688 -------RNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFS 745

  Fly   179 KIIYHTRTRKENDGDFKAEHV-SFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNV 242
            .|.|....:...:.....:.| :.:.||.:||.:.:...|........|......|::.:..||.
Human   746 VIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNA 810

  Fly   243 ARGGLVNQTDLHDALTNGTISAAGLDVTTPEPLP-ANSPLLNVPNCVILPHMGTQTMKTTIEMGL 306
            ||||||::..|..||..|.|..|.|||...||.. |..||.:.||.:..||....:.:.::||..
Human   811 ARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMRE 875

  Fly   307 LAANNILNAIEGK 319
            .||..|..||.|:
Human   876 AAATEIRRAITGR 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31673NP_724294.1 LdhA 9..320 CDD:223980 92/338 (27%)
GDH 9..318 CDD:240626 91/335 (27%)
CTBP2NP_073713.2 CtBP_dh 574..892 CDD:240624 90/329 (27%)
SerA 590..900 CDD:223189 86/313 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.