DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and GUK1

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_010742.1 Gene:GUK1 / 852065 SGDID:S000002862 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:63/207 - (30%)
Similarity:99/207 - (47%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 KTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNE 474
            :.:|:.|.||.|:.||..:|.....|.||..:..|:|..||.|.||..|.|:..:|.:..::|||
Yeast     3 RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNE 67

  Fly   475 FLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTI 539
            |:|:.:.:||.||:.:.|:|.|..||:.||||.....:|.:....||....:|:|.|.:|.||. 
Yeast    68 FIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKK- 131

  Fly   540 YADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI 604
                                 |...|...|.||:     :..|.|...|.::.:....   |.||
Yeast   132 ---------------------RLEGRGTETEESI-----NKRLSAAQAELAYAETGAH---DKVI 167

  Fly   605 VNEDFDETFRQV 616
            ||:|.|:.::::
Yeast   168 VNDDLDKAYKEL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918
PDZ_signaling 173..250 CDD:238492
SH3_MPP 287..347 CDD:212796
Guanylate_kin 408..622 CDD:279019 63/207 (30%)
GuKc 418..622 CDD:214504 61/199 (31%)
GUK1NP_010742.1 guanyl_kin 3..185 CDD:213788 63/207 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.