Sequence 1: | NP_724288.3 | Gene: | vari / 35343 | FlyBaseID: | FBgn0250785 | Length: | 636 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010742.1 | Gene: | GUK1 / 852065 | SGDID: | S000002862 | Length: | 187 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 207 | Identity: | 63/207 - (30%) |
---|---|---|---|
Similarity: | 99/207 - (47%) | Gaps: | 30/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 410 KTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNE 474
Fly 475 FLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTI 539
Fly 540 YADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI 604
Fly 605 VNEDFDETFRQV 616 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vari | NP_724288.3 | L27 | <105..128 | CDD:280918 | |
PDZ_signaling | 173..250 | CDD:238492 | |||
SH3_MPP | 287..347 | CDD:212796 | |||
Guanylate_kin | 408..622 | CDD:279019 | 63/207 (30%) | ||
GuKc | 418..622 | CDD:214504 | 61/199 (31%) | ||
GUK1 | NP_010742.1 | guanyl_kin | 3..185 | CDD:213788 | 63/207 (30%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |