DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and Mpp1

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_001032748.1 Gene:Mpp1 / 652956 RGDID:1594331 Length:467 Species:Rattus norvegicus


Alignment Length:514 Identity:171/514 - (33%)
Similarity:264/514 - (51%) Gaps:85/514 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 EQRLKAAGGSTSQLEIASQRQTGGYLFTE---DVLNTKMPVETIKMVGLRRDPSKPLGLTVEL-D 193
            ||.|:..||...  |..|.|...|.:.|.   |:...:.....:::|...:. ::|:|:|::| |
  Rat    29 EQLLRNRGGRGD--EAQSDRAEDGAVRTNGSVDLGEEEEAARGVRVVRFEKS-AEPMGITLKLND 90

  Fly   194 EFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV--RTPDELQVEVSRAKENLTLKIGPNVDE 256
            :.....|||||.||...:|..|||||.|||:|||.|  |:.|:||..:...:..::||:.|.   
  Rat    91 KAASCTVARILHGGAAHRQGSLHVGDEILEINGTDVTGRSVDQLQRAMKETRGTISLKVIPR--- 152

  Fly   257 EIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIIN 321
                          :|:.:.:|:      .::||.|.|:|.:|.|:||::.||.|.:||::|:||
  Rat   153 --------------QQSRLPALQ------MFVRAQFDYDPQKDDLIPCKEAGLAFSTGDVIQVIN 197

  Fly   322 VKDPNWWQAKNITAESDKIGLIPSQELEERRKAF---VAP-EADYVHKIGICGTRISKRKRKTMY 382
            ..|.||||.:.........||:||.||:|.|.|.   ||| ||......|      .|:|.|..|
  Rat   198 KDDGNWWQGRVQGNARGSAGLLPSPELQEWRAASAAQVAPAEAPSCSPFG------KKKKCKDKY 256

  Fly   383 RSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRP 447
            .:..:..||:.:::.||||.|:|.|:||||||||.|||||..:||.|:..:.::|....|||:||
  Rat   257 LAKHSAIFDRLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALLAQNPERFAYPAPHTTRP 321

  Fly   448 KRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNAL 512
            .|..|.:|:.|.|:..|||...:..|||||:|...|:::||.|.:::.:...|::.:||..|..|
  Rat   322 PRKGEADGAEYHFVSAEEMARGIAANEFLEFGSFRGDMFGTRLDAVRRIHECGQVAVLDIEPQTL 386

  Fly   513 KILHNSQELMPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLY 577
            |.:..: ||.||::|:|.                                :.:.|.| |:|..|.
  Rat   387 KAVRTA-ELSPFIVFIAP--------------------------------TDQGAET-EALRQLR 417

  Fly   578 EDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY 636
            .|.|.         ::.:|...||:.:|:...|||..::.|..|:...:.|||||:|:|
  Rat   418 ADSDA---------IRGRYAHLFDLCLVHNGVDETLGRLCEAFDRACADPQWVPVSWVY 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918
PDZ_signaling 173..250 CDD:238492 31/79 (39%)
SH3_MPP 287..347 CDD:212796 26/59 (44%)
Guanylate_kin 408..622 CDD:279019 67/213 (31%)
GuKc 418..622 CDD:214504 59/203 (29%)
Mpp1NP_001032748.1 PDZ 80..150 CDD:278991 31/69 (45%)
SH3_MPP1 163..224 CDD:213013 26/60 (43%)
Guanylate_kin 282..452 CDD:279019 67/212 (32%)
GuKc 292..455 CDD:214504 60/205 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D364535at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.