DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and Guk1

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:XP_006246539.1 Gene:Guk1 / 303179 RGDID:1309638 Length:266 Species:Rattus norvegicus


Alignment Length:218 Identity:67/218 - (30%)
Similarity:101/218 - (46%) Gaps:34/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 KTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNE 474
            :.:||.|.||.|:.||..:|.......||..:.||:|..|..||:|..|:|:.||.|:..:...:
  Rat    73 RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGD 137

  Fly   475 FLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTI 539
            |:|:.|.:||||||..::::.|....|:|:||.....::.:..: :|.|..|.|..|.|:.|:. 
  Rat   138 FIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKT-DLHPIYISVQPPSMDVLEQ- 200

  Fly   540 YADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI 604
                                 |...|...|.||||.     .|.|.  ::.....|....||:||
  Rat   201 ---------------------RLRQRNTETEESLAK-----RLAAA--QADMESSKEPGLFDLVI 237

  Fly   605 VNEDFDETFRQVVETLDQMSHEE 627
            ||::.||.:    .||.|...||
  Rat   238 VNDNLDEAY----VTLKQALSEE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918
PDZ_signaling 173..250 CDD:238492
SH3_MPP 287..347 CDD:212796
Guanylate_kin 408..622 CDD:279019 64/211 (30%)
GuKc 418..622 CDD:214504 61/203 (30%)
Guk1XP_006246539.1 Guanylate_kin 71..256 CDD:279019 65/216 (30%)
guanyl_kin 73..255 CDD:213788 65/215 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.