DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and SPBC1198.05

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_595074.1 Gene:SPBC1198.05 / 2539674 PomBaseID:SPBC1198.05 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:218 Identity:63/218 - (28%)
Similarity:109/218 - (50%) Gaps:36/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 TRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEM 466
            :::...:.|.:|:.|.||||:.||..||:....||.|..:.||:|..||.|::|..|.|:.:||.
pombe    11 SKLVTLKLKPVVVFGPSGVGKSTLLKRLLKDHGDKLGFSVSHTTRTPRAGEKDGIDYHFVTKEEF 75

  Fly   467 EEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDC-APNALKILHNSQELMPFVIFVAA 530
            ::.|...:|:|:...:||:|||.:.:|:::....:..|||. ....|::  .:..:....:|:|.
pombe    76 QKLVAEEKFVEWAVFSGNMYGTSIMAIQELEAVNKKAILDIDLQGVLQV--KASPIDAQYVFLAP 138

  Fly   531 PGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRK 595
            |.:|||:.     |..|...    :.:|:|.....|||               |.:|.|      
pombe   139 PSIEQLEV-----RLRGRGT----ENESAILQRLERAR---------------AEIEYS------ 173

  Fly   596 YEK--YFDMVIVNEDFDETFRQV 616
             ||  .||.:|||:|.::.::|:
pombe   174 -EKPGNFDALIVNDDVEKAYKQL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918
PDZ_signaling 173..250 CDD:238492
SH3_MPP 287..347 CDD:212796
Guanylate_kin 408..622 CDD:279019 63/212 (30%)
GuKc 418..622 CDD:214504 60/202 (30%)
SPBC1198.05NP_595074.1 Gmk 17..201 CDD:223272 63/212 (30%)
guanyl_kin 19..201 CDD:213788 63/210 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.