DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and PDZD2

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:XP_005248326.1 Gene:PDZD2 / 23037 HGNCID:18486 Length:2873 Species:Homo sapiens


Alignment Length:321 Identity:59/321 - (18%)
Similarity:109/321 - (33%) Gaps:117/321 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRWSARSRRQARQDKVELLAR-------------------NNKVNGEDDTSDNAAFRNSTDLSD 46
            ||:....|:..:.:|.:.|.::                   :.:.:||:|...:::.:.:...:|
Human   410 MVQLVVASKENSAEDLLRLTSKSLPDLTSSVEDVSSWTDNEDQEADGEEDEGTSSSVQRAMPGTD 474

  Fly    47 H---------------------DEIFLK-----GLLRSNSNTPHKELMLNPTEPQPVPLFLPAHL 85
            .                     ::|.||     |:.|..|...:.|||:...:|:          
Human   475 EPQDVCGAEESKGNLESPKQGSNKIKLKSRLSGGVHRLESVEEYNELMVRNGDPR---------- 529

  Fly    86 NNKPICDDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRL-KAAGGSTSQLEIA 149
                     ||....||......|.:||            |...|..|..: |.:..|.|..::.
Human   530 ---------IRMLEVSRDGRKHSLPQLL------------DSSSASQEYHIVKKSTRSLSTTQVE 573

  Fly   150 SQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTV---------ELDEFKQLVVARILA 205
            |..:    |....|         |.::||.::..|.||.::         ::..|    |..|..
Human   574 SPWR----LIRPSV---------ISIIGLYKEKGKGLGFSIAGGRDCIRGQMGIF----VKTIFP 621

  Fly   206 GGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVS 266
            .|...:...|..||.||:|||.|::              .||.:...:..::|:||.:.::
Human   622 NGSAAEDGRLKEGDEILDVNGIPIK--------------GLTFQEAIHTFKQIRSGLFVLT 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918 4/22 (18%)
PDZ_signaling 173..250 CDD:238492 21/85 (25%)
SH3_MPP 287..347 CDD:212796
Guanylate_kin 408..622 CDD:279019
GuKc 418..622 CDD:214504
PDZD2XP_005248326.1 PDZ_signaling 335..416 CDD:238492 2/5 (40%)
PDZ_signaling 589..670 CDD:238492 22/98 (22%)
PDZ_signaling 726..810 CDD:238492
PDZ_signaling 2623..2694 CDD:238492
PDZ 2785..2867 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.