DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and LRGUK

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_001352629.1 Gene:LRGUK / 136332 HGNCID:21964 Length:1131 Species:Homo sapiens


Alignment Length:599 Identity:120/599 - (20%)
Similarity:217/599 - (36%) Gaps:166/599 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ESRELAKLLAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIASQRQTG----------GYLF 159
            ||.|...|..:..|..:||......||:  .|..:|..|.|:.: :...:|          ||:.
Human    89 ESSESEMLNLEEEFDGVLREEAVAKALH--HLGRSGSGTEQVYL-NLTLSGCNLIDVSILCGYVH 150

  Fly   160 TEDVLNTKMPVETIKMVG-----LRRDPSK-----------PLGLTV------ELDEFKQLVVAR 202
            .:.:..:...:|.:..|.     |..:.|:           |..|..      ::.|...|....
Human   151 LQKLDLSANKIEDLSCVSCMPYLLELNASQNNLTTFFNFKPPKNLKKADFSHNQISEICDLSAYH 215

  Fly   203 ILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSG 267
            .|...::|       |:.|.|::|  :...:.| :.:|.|...:|...|.|   ::......:|.
Human   216 ALTKLILD-------GNEIEEISG--LEMCNNL-IHLSLANNKITTINGLN---KLPIKILCLSN 267

  Fly   268 GQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKN 332
            .|::.  |..||.       ::||...:.|.:.:...:.:    ::.|:|::||::|       |
Human   268 NQIEM--ITGLED-------LKALQNLDLSHNQISSLQGL----ENHDLLEVINLED-------N 312

  Fly   333 ITAESDKIGLI--------------PSQELEE----------------RRKAFVAPEADYVHKIG 367
            ..||..:|..|              |.||..|                ::|..|..:...|:|..
Human   313 KIAELREIEYIKNLPILRVLNLLENPIQEKSEYWFFVIFMLLRLTELDQKKIKVEEKVSAVNKYD 377

  Fly   368 ICGTRISKRKRKT-MYRSVANCE--FDKAELLLYEEVTRMP----PFRRKTLVLIGVSGVGRRTL 425
            .....::.:...| :..||...:  ||          :.:|    |:  ..|:|.|....|:|.|
Human   378 PPPEVVAAQDHLTHVVNSVMQPQRIFD----------STLPSLDAPY--PMLILAGPEACGKREL 430

  Fly   426 KNRLIN--SDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFL---EYGEHNGNL 485
            .:||..  |...::||.  ||:||....|.:...|.|:.::..:|.|...:|:   .||.|.   
Human   431 AHRLCRQFSTYFRYGAC--HTTRPPYFGEGDRVDYHFISQDVFDEMVNMGKFILTFSYGNHK--- 490

  Fly   486 YGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRR---ATG 547
            ||.:..:::.:...|   :..|                  |.:...|:..||..|.:.|   ...
Human   491 YGLNRDTVEGIARDG---LASC------------------IHMEIEGVRSLKYSYFEPRYILVVP 534

  Fly   548 SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDET 612
            .|:.         ::.....|  :.|.|..|.:..|:.|:....:.:.:..|||.||..:|.|..
Human   535 MNKE---------KYEGYLRR--KGLFSRAEIEFAVSRVDLYIKINQNFPGYFDEVINADDLDVA 588

  Fly   613 FRQVVETLDQMSHE 626
            :::    |.|:..|
Human   589 YQK----LSQLIRE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918 7/22 (32%)
PDZ_signaling 173..250 CDD:238492 17/98 (17%)
SH3_MPP 287..347 CDD:212796 14/73 (19%)
Guanylate_kin 408..622 CDD:279019 49/221 (22%)
GuKc 418..622 CDD:214504 46/211 (22%)
LRGUKNP_001352629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..96 3/6 (50%)
LRR 1 129..149 2/20 (10%)
leucine-rich repeat 131..150 CDD:275380 3/18 (17%)
LRR <150..>337 CDD:227223 38/219 (17%)
LRR 2 150..171 2/20 (10%)
leucine-rich repeat 151..172 CDD:275380 2/20 (10%)
LRR 3 172..193 2/20 (10%)
leucine-rich repeat 173..194 CDD:275380 3/20 (15%)
LRR 4 194..215 3/20 (15%)
leucine-rich repeat 195..216 CDD:275380 3/20 (15%)
LRR 5 216..237 6/29 (21%)
leucine-rich repeat 217..238 CDD:275380 6/29 (21%)
LRR 6 238..259 6/24 (25%)
leucine-rich repeat 258..281 CDD:275380 5/31 (16%)
LRR 7 260..280 5/28 (18%)
LRR 8 281..302 3/24 (13%)
leucine-rich repeat 282..300 CDD:275380 2/21 (10%)
LRR 9 303..324 8/27 (30%)
leucine-rich repeat 304..328 CDD:275380 9/30 (30%)
GMPK 416..592 CDD:238026 48/216 (22%)
Atrophin-1 <784..1126 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.