DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vari and LOC100537443

DIOPT Version :9

Sequence 1:NP_724288.3 Gene:vari / 35343 FlyBaseID:FBgn0250785 Length:636 Species:Drosophila melanogaster
Sequence 2:XP_003199722.2 Gene:LOC100537443 / 100537443 -ID:- Length:201 Species:Danio rerio


Alignment Length:238 Identity:47/238 - (19%)
Similarity:98/238 - (41%) Gaps:54/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 YEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMD 462
            |:.|.::....|:.::::|..   ...:|:.|:.....|:...:|...:.:              
Zfish    10 YQRVLKVESTNRRPVLILGPL---VEPIKDMLLREAPGKYCRCLPEGMKAQ-------------- 57

  Fly   463 REEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIF 527
            ::.:|..|::..|::|...:|:...|.:.|||::......|:||.||:|::.|| :..:.|.|||
Zfish    58 QQAIERGVKDCLFIDYKRRSGHFDVTTVASIKEITEKDCHCLLDIAPHAIERLH-AVSIYPIVIF 121

  Fly   528 VAAPGMEQLK----TIYADRRATGSNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEE 588
            :.....:|:|    .:|.        |:....:.|..:|                        |.
Zfish   122 IRYRNAKQIKEQKDPVYL--------RDKVSQKHSKEQF------------------------ES 154

  Fly   589 SSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVP 631
            :..:::.|.|||..|:.......|..|::..:||..::..|:|
Zfish   155 AQRIEQDYSKYFTGVVQAGALSNTCTQIMAIVDQEQNKVLWIP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
variNP_724288.3 L27 <105..128 CDD:280918
PDZ_signaling 173..250 CDD:238492
SH3_MPP 287..347 CDD:212796
Guanylate_kin 408..622 CDD:279019 41/217 (19%)
GuKc 418..622 CDD:214504 39/207 (19%)
LOC100537443XP_003199722.2 NK 34..190 CDD:327404 41/202 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.