DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pomp and AT1G67250

DIOPT Version :10

Sequence 1:NP_610057.1 Gene:Pomp / 35342 FlyBaseID:FBgn0032884 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_564892.1 Gene:AT1G67250 / 843045 AraportID:AT1G67250 Length:141 Species:Arabidopsis thaliana


Alignment Length:72 Identity:28/72 - (38%)
Similarity:38/72 - (52%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GLGVPLKMGMERFAARQVGRLPF-LSSSNFMDDVLTGRCDSIGFEDFMNLPENSEHMRQP--HAV 125
            |..:||||.|:|....:..|.|. :.||....:|.||..|..||||::|.|.:||..:..  |..
plant    60 GTALPLKMDMDRQILSRFQRPPGPIPSSMLGLEVYTGAVDDFGFEDYLNDPRDSETFKPVDFHHG 124

  Fly   126 VEKSLGI 132
            :|..|||
plant   125 MEVRLGI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PompNP_610057.1 UMP1 15..130 CDD:461627 25/68 (37%)
AT1G67250NP_564892.1 UMP1 16..129 CDD:461627 25/68 (37%)

Return to query results.
Submit another query.