DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pomp and APE1

DIOPT Version :10

Sequence 1:NP_610057.1 Gene:Pomp / 35342 FlyBaseID:FBgn0032884 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001190435.1 Gene:APE1 / 833856 AraportID:AT5G38660 Length:431 Species:Arabidopsis thaliana


Alignment Length:161 Identity:40/161 - (24%)
Similarity:68/161 - (42%) Gaps:39/161 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLKVQPAEVSV-----LNATGRVGMPTEANCLNQLAH-VHRLRDSELNYNEHQYNRNMQMLRNHE 63
            |:|..|.::.|     ....||..|.::    .::|| :..:::..|.:..|....:  :||:|.
plant   267 SMKKSPRKLKVERRRKKKRRGRGEMESQ----KKIAHEIGGMKNDALRFGLHGVKSD--ILRSHP 325

  Fly    64 ------------------------GLGVPLKMGMERFAARQVGRLPF-LSSSNFMDDVLTGRCDS 103
                                    |..:||||.::|....:..|.|. :.||....:|.||..|:
plant   326 LETAYESGKQSQEEMKRRVITHTYGAALPLKMDLDRQILSRFQRPPGPIPSSMLGLEVYTGALDN 390

  Fly   104 IGFEDFMNLPENSEHMRQP--HAVVEKSLGI 132
            .||||::|.|..||.::..  |..:|..||:
plant   391 FGFEDYLNDPRESETLKPVDFHHGMEVRLGL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PompNP_610057.1 UMP1 15..130 CDD:461627 35/147 (24%)
APE1NP_001190435.1 DUF2854 110..260 CDD:431609
UMP1 306..419 CDD:461627 29/114 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.