DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pomp and pomp

DIOPT Version :10

Sequence 1:NP_610057.1 Gene:Pomp / 35342 FlyBaseID:FBgn0032884 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001003424.1 Gene:pomp / 445030 ZFINID:ZDB-GENE-040801-10 Length:142 Species:Danio rerio


Alignment Length:101 Identity:48/101 - (47%)
Similarity:59/101 - (58%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NQLAHVHRLRDSELNYNEHQYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLPFLSSSNFMDDV 96
            |:|...|.|..||.|:..:|...|...|||.:||..|||:.||..||:|:.|||||.|||...|.
Zfish    41 NELLPSHPLELSEKNFQLNQDKMNFNTLRNIQGLHAPLKLQMEYRAAKQIQRLPFLPSSNLALDT 105

  Fly    97 LTGRCDSIGFEDFMNLPENSEHMRQPHAVVEKSLGI 132
            |.|..|:|||||.:|.|...|.|..||.:.|..||:
Zfish   106 LRGSDDTIGFEDILNDPVQCEMMGDPHIMTEYKLGL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PompNP_610057.1 UMP1 15..130 CDD:461627 46/97 (47%)
pompNP_001003424.1 UMP1 26..139 CDD:461627 46/97 (47%)

Return to query results.
Submit another query.