DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and HB-7

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_182191.1 Gene:HB-7 / 819280 AraportID:AT2G46680 Length:258 Species:Arabidopsis thaliana


Alignment Length:48 Identity:20/48 - (41%)
Similarity:30/48 - (62%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 YTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAK 345
            ::|.|...||..:.:...:..|:|.:||:.|.|..|||.|||||:||:
plant    36 FSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRAR 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 20/48 (42%)
HB-7NP_182191.1 Homeodomain 35..85 CDD:459649 20/48 (42%)
HALZ 87..126 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.