| Sequence 1: | NP_001260641.1 | Gene: | cad / 35341 | FlyBaseID: | FBgn0000251 | Length: | 445 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_182191.1 | Gene: | HB-7 / 819280 | AraportID: | AT2G46680 | Length: | 258 | Species: | Arabidopsis thaliana |
| Alignment Length: | 48 | Identity: | 20/48 - (41%) |
|---|---|---|---|
| Similarity: | 30/48 - (62%) | Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 298 YTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAK 345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cad | NP_001260641.1 | Homeodomain | 293..348 | CDD:459649 | 20/48 (42%) |
| HB-7 | NP_182191.1 | Homeodomain | 35..85 | CDD:459649 | 20/48 (42%) |
| HALZ | 87..126 | CDD:460477 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||