powered by:
Protein Alignment cad and HB-7
DIOPT Version :9
Sequence 1: | NP_001260641.1 |
Gene: | cad / 35341 |
FlyBaseID: | FBgn0000251 |
Length: | 445 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_182191.1 |
Gene: | HB-7 / 819280 |
AraportID: | AT2G46680 |
Length: | 258 |
Species: | Arabidopsis thaliana |
Alignment Length: | 48 |
Identity: | 20/48 - (41%) |
Similarity: | 30/48 - (62%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 YTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAK 345
::|.|...||..:.:...:..|:|.:||:.|.|..|||.|||||:||:
plant 36 FSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRAR 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
cad | NP_001260641.1 |
Homeobox |
295..347 |
CDD:278475 |
20/48 (42%) |
HB-7 | NP_182191.1 |
Homeobox |
35..85 |
CDD:395001 |
20/48 (42%) |
HALZ |
87..126 |
CDD:396657 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.