DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Msx1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_112321.2 Gene:Msx1 / 81710 RGDID:620929 Length:303 Species:Rattus norvegicus


Alignment Length:325 Identity:77/325 - (23%)
Similarity:112/325 - (34%) Gaps:113/325 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FHSAAAASAGEWHSPASSTADNF------------VQNVPTSAHQLMQQHHHHHAHASSSSASSG 124
            |...|...||:....|::||...            ...:|.|...||..|....|..|...||.|
  Rat    21 FAKPAGGGAGQAPGAAAATATAMGTDEEGAKPKVPASLLPFSVEALMADHRKPGAKESVLVASEG 85

  Fly   125 SSSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSE 189
            :.::||:                                       .||:            |:.
  Rat    86 AQAAGGS---------------------------------------VQHL------------GTR 99

  Fly   190 ISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNN---NRTSPSKPP 251
            ..|.|||.:.|||                       .|..|.:......:..:   ...||.|..
  Rat   100 PGSLGAPDAPSSP-----------------------GPLGHFSVGGLLKLPEDALVKAESPEKLD 141

  Fly   252 YFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYI 316
            ...||:.|.:  .|.|....||....|.       |.:|..|.|..:|..|.|.||:::...:|:
  Rat   142 RTPWMQSPRF--SPPPARRLSPPACTLR-------KHKTNRKPRTPFTTAQLLALERKFRQKQYL 197

  Fly   317 TIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQL-LDAKAKLEP 380
            :|..::|.:.:|||:|.||||||||||||.::              :|.|:..:| :.||..|.|
  Rat   198 SIAERAEFSSSLSLTETQVKIWFQNRRAKAKR--------------LQEAELEKLKMAAKPMLPP 248

  Fly   381  380
              Rat   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
Msx1NP_112321.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.