DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and cdx4

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571184.2 Gene:cdx4 / 798281 ZFINID:ZDB-GENE-980526-330 Length:270 Species:Danio rerio


Alignment Length:340 Identity:121/340 - (35%)
Similarity:143/340 - (42%) Gaps:97/340 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHH---HHAHASSSSASSGSSSSGGAP 132
            |:|..|...:|     .|....|||.   |..:.....:||   ...||.|:.|       .|||
Zfish    13 MYHQGAVRRSG-----ISLPPQNFVS---TPQYSDFTGYHHVPNMETHAQSAGA-------WGAP 62

  Fly   133 -GAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAP 196
             |||:.:....|:|                     |||       .:.:|      ...|||| |
Zfish    63 YGAPREDWGAYSLG---------------------PPN-------SISAP------MSNSSPG-P 92

  Fly   197 TSASSPHHHLAHHL-SAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPA 260
            .|..||.::..|.. |||.           .|...|......|.....|.|      :.||.|..
Zfish    93 VSYCSPDYNTMHGPGSAVL-----------PPPPENIPVAQLSPERERRNS------YQWMSKTV 140

  Fly   261 YPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELA 325
            .        |||            :||||||:||||||||.||||||||:..:||||||||||||
Zfish   141 Q--------SSS------------TGKTRTKEKYRVVYTDHQRLELEKEFHFNRYITIRRKSELA 185

  Fly   326 QTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAH 390
            ..|.|||||||||||||||||||..||....:....|..|:|...:.....   || .||.|..|
Zfish   186 VNLGLSERQVKIWFQNRRAKERKLIKKKLGQSDGSGGSVHSDPGSVSPLPV---PG-SLSPSDIH 246

  Fly   391 SMNPMAAMN-IPAMR 404
            .....|.|| :|:||
Zfish   247 GSLYPAQMNALPSMR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
cdx4NP_571184.2 Caudal_act 15..138 CDD:282574 45/189 (24%)
Homeobox 155..207 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7177
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4766
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm25485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1010.050

Return to query results.
Submit another query.