DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Nanog

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:248 Identity:55/248 - (22%)
Similarity:93/248 - (37%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 GLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNN---NS 238
            |||.|....|..|.|                           |:.|.::.|:..:..|.:   .|
Mouse     4 GLPGPHSLPSSEEAS---------------------------NSGNASSMPAVFHPENYSCLQGS 41

  Fly   239 VSNNNRTSPSKPPYFDWMKKPA---YPAQPQPDLSSSPNLEDLSDLLDASGKTR------TKDKY 294
            .:....|..:.|       :|:   .|.|..||.|:||..:..|...|...:..      .|.|.
Mouse    42 ATEMLCTEAASP-------RPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKM 99

  Fly   295 RVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK-------- 351
            |.|::..|...|:..:...:|:::::..||:..|:||.:|||.||||:|.|.::..|        
Mouse   100 RTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSN 164

  Fly   352 ----KGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNI 400
                |||.|         .:|           |.:|.|:...:.:|...::::
Mouse   165 GLIQKGSAP---------VEY-----------PSIHCSYPQGYLVNASGSLSM 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 20/54 (37%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 10/52 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 12/55 (22%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 21/58 (36%)
Homeodomain 98..153 CDD:459649 20/54 (37%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 14/28 (50%)
PTZ00395 <190..>250 CDD:185594 1/8 (13%)
10 X repeats starting with a Trp in each unit 198..247 55/248 (22%)
Sufficient for transactivation activity 198..247 55/248 (22%)
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.