DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Nkx6-3

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:269 Identity:63/269 - (23%)
Similarity:96/269 - (35%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 APPNHQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVAN-NNNNNNNNNNSPST 229
            :||.....:|.|.|.....:....:::|.:...:..||         ||. ...::......|..
  Rat    39 SPPGLGPQLAAGTPHGITDILSRPVATPNSSLLSGYPH---------VAGFGGLSSQGVYYGPQV 94

  Fly   230 HNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKY 294
            .:.:...|......|...:.... || :....|....||        .|||.:.....||.    
  Rat    95 GSFSKTGNEYPTRTRNCWADTGQ-DW-RGSTRPCSNTPD--------PLSDTIHKKKHTRP---- 145

  Fly   295 RVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVM 359
              .:|..|...|||.:..::|:....::.||.:|.::|.|||:||||||.|.||  |...:|:  
  Rat   146 --TFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK--KSALEPS-- 204

  Fly   360 GVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIP----------AMRLHPHLAAHSH 414
                          :.....|| ..|...|.|.|.....|.|          .:.|..|.||  .
  Rat   205 --------------SSTPRAPG-GASGDRAASENEDDEYNKPLDPDSDDEKIRLLLRKHRAA--F 252

  Fly   415 SLAAVAAHS 423
            |:.::.|||
  Rat   253 SVLSLGAHS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.