DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Cdx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:289 Identity:111/289 - (38%)
Similarity:137/289 - (47%) Gaps:62/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGSSSSGG----- 130
            |:.|:...|.|...:|     .|||     |..|......:|.|.|::::|:..|:.|.|     
  Rat    13 MYPSSVRHSGGLNLAP-----QNFV-----SPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPT 67

  Fly   131 APGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGA 195
            |.||| |.|..:....|||.....|....:||..:|...:                    |||..
  Rat    68 AYGAP-LREDWNGYAPGGAAAANAVAHGLNGGSPAAAMGY--------------------SSPAE 111

  Fly   196 PTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPS--KPPYFDWMKK 258
            ..:...||||..|..:|.:..:......|..|.      ...:.:...:.|||  :....:||:|
  Rat   112 YHAHHHPHHHPHHPAAAPSCASGLLQTLNPGPP------GPAATAAAEQLSPSGQRRNLCEWMRK 170

  Fly   259 PAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSE 323
            ||     ||.|.|..             ||||||||||||||.||||||||:..|||||||||:|
  Rat   171 PA-----QPSLGSQV-------------KTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAE 217

  Fly   324 LAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            ||.||.|||||||||||||||||||.|||
  Rat   218 LAATLGLSERQVKIWFQNRRAKERKINKK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 44/51 (86%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 46/193 (24%)
Homeobox 189..241 CDD:278475 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7001
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4386
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm44943
orthoMCL 1 0.900 - - OOG6_107786
Panther 1 1.100 - - O PTHR24332
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.910

Return to query results.
Submit another query.