Sequence 1: | NP_001260641.1 | Gene: | cad / 35341 | FlyBaseID: | FBgn0000251 | Length: | 445 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_072158.1 | Gene: | Vax1 / 64571 | RGDID: | 621132 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 59/199 - (29%) |
---|---|---|---|
Similarity: | 85/199 - (42%) | Gaps: | 44/199 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 260 AYPAQPQPDLSSSPNLEDLSD----------------LLDASGKTR-----------TKDKYRVV 297
Fly 298 YTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVG 362
Fly 363 VQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAM----------NIPAMRLHPHLAAHSHSLA 417
Fly 418 AVAA 421 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cad | NP_001260641.1 | Homeobox | 295..347 | CDD:278475 | 25/51 (49%) |
Vax1 | NP_072158.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 50..69 | 4/18 (22%) | |||
vax upstream domain | 72..99 | 4/26 (15%) | |||
homeobox | 100..159 | 26/60 (43%) | |||
Homeobox | 103..156 | CDD:278475 | 25/52 (48%) | ||
vax downstream domain | 178..189 | 4/13 (31%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 236..267 | ||||
vax terminal domain | 315..323 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |