DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and lbx2

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:178 Identity:44/178 - (24%)
Similarity:77/178 - (43%) Gaps:25/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 NSVSNNNRTSPSKP-PYFDWMKKPAYPAQPQPDLSSSPNLEDLSDL--LDASGKTRTKDKYRVVY 298
            :|.|.|..::||.| ...:.:....:.......:.::...|.::..  ..||.|.|   |.|..:
Zfish    72 SSASRNGISAPSSPLCALEELASKTFKGLEVSVIQAAEGREHINAFGQRQASKKRR---KSRTAF 133

  Fly   299 TDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERK---------QNKKGS 354
            |:.|..||||.:...:|::...:.::||.|.|:..||..||||||||.::         ::.|..
Zfish   134 TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESLKKI 198

  Fly   355 DPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPA 402
            .|..:          |.|.:...:|.....|..::.|::|.|....|:
Zfish   199 PPQAL----------QKLVSMEDMEDAHGGSGPISPSLSPRAFPQSPS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 23/54 (43%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Homeodomain 127..183 CDD:459649 24/58 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.