DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and urad

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001073641.1 Gene:urad / 557735 ZFINID:ZDB-GENE-070112-472 Length:174 Species:Danio rerio


Alignment Length:62 Identity:14/62 - (22%)
Similarity:22/62 - (35%) Gaps:9/62 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 YSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAAVAAHSHQLQQQ 429
            :..|.|.:|::.       ...||:.......|  :|.||.||........:...|.:.|.|
Zfish    38 FKDLADIEARIS-------EFIHSLPDSGKEGI--LRCHPDLAGRDLQSGTLTPESQEEQSQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475
uradNP_001073641.1 OHCU_decarbox 7..162 CDD:401335 14/62 (23%)
Substrate binding 84..88 1/3 (33%)
Substrate binding 119..123
Microbody targeting signal. /evidence=ECO:0000255 172..174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.