DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Emx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001102639.1 Gene:Emx2 / 499380 RGDID:1564797 Length:253 Species:Rattus norvegicus


Alignment Length:257 Identity:63/257 - (24%)
Similarity:100/257 - (38%) Gaps:51/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEI 190
            |.:..:|..|.||..:|:.....||.|             ...|.....||.:..||        
  Rat    37 SYANSSPINPFLNGFHSAAAAAAAGRG-------------VYSNPDLVFAEAVSHPP-------- 80

  Fly   191 SSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDW 255
             :|..|.....|.|.||.|               ..||:|    :.:.:..:.:..||  .::.|
  Rat    81 -NPAVPVHPVPPPHALAAH---------------PLPSSH----SPHPLFASQQRDPS--TFYPW 123

  Fly   256 M-KKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIR 319
            : .:..|.........:||....|.:.|     .|...:.|..::..|.|.||..:..:.|:...
  Rat   124 LIHRYRYLGHRFQGNDTSPESFLLHNAL-----ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGA 183

  Fly   320 RKSELAQTLSLSERQVKIWFQNRRAKERKQ--NKKGSDPNVMGVGVQHADYSQLLDAKAKLE 379
            .:.:||.:|||:|.|||:||||||.|.::|  .::|||......|..|.:..::...:|..|
  Rat   184 ERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
Emx2NP_001102639.1 Homeobox 159..212 CDD:395001 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.