DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Dr

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster


Alignment Length:407 Identity:101/407 - (24%)
Similarity:145/407 - (35%) Gaps:135/407 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NTLPYTQKHSAA----NLAYASAAGQPWNWTPNYHHTPPNHQFLGDVDSSHAA-------HHAAA 60
            :|.|.|..:.||    ||. :|||..|.:...:....||         :|.||       |.||.
  Fly   142 DTRPRTPPNQAADGPQNLT-SSAATSPISQASSTPPPPP---------ASAAAQVPANTFHPAAV 196

  Fly    61 AHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGS 125
            ||..     |:..:|.||:|......|             .|.||.||.....|.|:|..||:.|
  Fly   197 AHHA-----HLLQAAHAAAAAHAQHQA-------------MAAQLRQQQQQADARANSPPASTSS 243

  Fly   126 SSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEI 190
                          |.||..:|.|.|       :.|...|.|..:::|      ||    .||..
  Fly   244 --------------TPSSTPLGSALG-------SQGNVASTPAKNERH------SP----LGSHT 277

  Fly   191 SSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSP-STHNNNNNNNSVSNNNRTSPSKPPYFD 254
            .|...........|...|.....:..:..:.|.::|| ||.:..:.    |..:..||..||...
  Fly   278 DSELEYDEEMLQDHEADHDEEEDSIVDIEDMNADDSPRSTPDGLDG----SGKSLESPHGPPPGS 338

  Fly   255 WMK----KPA------YPAQPQP------------------------------------------ 267
            .|:    .||      .|.:|.|                                          
  Fly   339 HMQSTILSPAALASGHVPIRPTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFGG 403

  Fly   268 DLSSSPNLE-DLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLS 331
            |.:..|.:: :|.       |.:...|.|..:|..|.|.|||::...:|::|..::|.:.:|.|:
  Fly   404 DANEPPRIKCNLR-------KHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLT 461

  Fly   332 ERQVKIWFQNRRAKERK 348
            |.||||||||||||.::
  Fly   462 ETQVKIWFQNRRAKAKR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
DrNP_477324.1 Homeobox 424..477 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.