DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and MSX2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_002440.2 Gene:MSX2 / 4488 HGNCID:7392 Length:267 Species:Homo sapiens


Alignment Length:297 Identity:68/297 - (22%)
Similarity:111/297 - (37%) Gaps:85/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SSSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATD--------------------GGPGSAPPN 169
            |.|.|....:|  :|...::..|...|.||..||.:                    ..|..|.|.
Human     3 SPSKGNDLFSP--DEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPL 65

  Fly   170 HQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNN 234
            ..:..:.|....|:.:||.......:|.....|.                     .:.|..:.|:
Human    66 PAESASAGATLRPLLLSGHGAREAHSPGPLVKPF---------------------ETASVKSENS 109

  Fly   235 NNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYT 299
            .:.:.               ||::|...:.|...:  ||....|.       |.:|..|.|..:|
Human   110 EDGAA---------------WMQEPGRYSPPPRHM--SPTTCTLR-------KHKTNRKPRTPFT 150

  Fly   300 DFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQ 364
            ..|.|.||:::...:|::|..::|.:.:|:|:|.||||||||||||.::              :|
Human   151 TSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKR--------------LQ 201

  Fly   365 HADYSQLLDAKAKLEPGLHLSHSLAHSM-NPMAAMNI 400
            .|:..:|   |...:|.|..|.||...: :|:.|.:|
Human   202 EAELEKL---KMAAKPMLPSSFSLPFPISSPLQAASI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 24/51 (47%)
MSX2NP_002440.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..147 9/39 (23%)
Homeobox 145..199 CDD:365835 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.