DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and nkx6.1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio


Alignment Length:371 Identity:86/371 - (23%)
Similarity:130/371 - (35%) Gaps:136/371 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LGDVDSSHAAHH------AAAAHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQ----NVPT 100
            :|.:|.|..:..      .||.|.|......::.:...:|.|    |||||:.....    .:|.
Zfish     4 VGQMDGSRQSAFLLNTPPLAALHSMTEMKTPLYPAYPLSSTG----PASSTSPTATSPNPGGIPV 64

  Fly   101 SAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGAPQ-LNE--TNSSIGVGGAGGGGGVGGATDGG 162
            |:..:          .:||..|:.:|:...|...|. :|:  :..|:....||            
Zfish    65 SSPGI----------KTSSGLSALASAQQCAIATPHGINDILSRPSVACSPAG------------ 107

  Fly   163 PGSAPPNHQQHIAEGLP-----SPPITVSGSEISSPG---APTSASSPHHHLAHHLSAVANNNNN 219
                       |..|||     |||        ..||   :|::|:          .|||     
Zfish   108 -----------ILSGLPRFSSLSPP--------PPPGLYFSPSAAA----------VAVA----- 138

  Fly   220 NNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDL------ 278
               ....|.|.               .|.:.|.| |           |.:..||:..|.      
Zfish   139 ---RYPKPLTE---------------LPGRTPIF-W-----------PGVMQSPHWRDARFACSP 173

  Fly   279 ---SDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQ 340
               |.|||..||   :...|..::..|...|||.:..::|:....::.||.:|.::|.|||:|||
Zfish   174 HQNSVLLDKDGK---RKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQ 235

  Fly   341 NRRAKERKQN-------KKGSD---PNVMGVGVQH---ADYSQLLD 373
            |||.|.||::       ||..|   ..:.|.....   .||::.||
Zfish   236 NRRTKWRKRHAAEMASAKKKQDSETERLKGASENEDDDDDYNKPLD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
nkx6.1NP_001002475.1 Homeobox 189..242 CDD:278475 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.