DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and CG15696

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:157 Identity:43/157 - (27%)
Similarity:69/157 - (43%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 ASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAY-- 261
            ||.|.|..||..|.|      :..:..||..              ..:.::.|.:||::...|  
  Fly    32 ASLPFHPYAHPASYV------SKESGGSPPA--------------SAAEAQIPVYDWLQYTRYHP 76

  Fly   262 PAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKY-RVVYTDFQRLELEKEYCTSRYITIRRKSELA 325
            |..|:....::|             ..||..:. |:.:|..|...||..|..|.|::....::||
  Fly    77 PKLPRALRQNAP-------------AKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLA 128

  Fly   326 QTLSLSERQVKIWFQNRRAKERKQNKK 352
            .:|.|:..:||||||||||:||::.::
  Fly   129 DSLELTNTRVKIWFQNRRARERREKRE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.