DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Ubx

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:399 Identity:97/399 - (24%)
Similarity:148/399 - (37%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YTQKHSAANLAYASAAGQPWNWTPNYHHTPPNHQFLGDVDSSHAAHHAAAAHQMY--------YN 67
            |...|.|..:|..|..          ||             ...|..||||::.:        |.
  Fly    12 YGHPHQATGMAMGSGG----------HH-------------DQTASAAAAAYRGFPLSLGMSPYA 53

  Fly    68 SHHM--------FHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSASSG 124
            :||:        :.::..|:..:.:...:........|:...|           .:......::|
  Fly    54 NHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADA-----------VNGYKDIWNTG 107

  Fly   125 SSSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAP-PNHQQHIAEGLP------SPP 182
            .|:.||..|           |.||.||.||.|||.:...|:|. .|.|.:.|.|:|      :|.
  Fly   108 GSNGGGGGG-----------GGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPD 161

  Fly   183 ITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNN---------NNNNS 238
            ..|.|...:|.|:|.|         |...:...|.:.:..|.|:....:..         |.|.:
  Fly   162 SRVGGYLDTSGGSPVS---------HRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCT 217

  Fly   239 VSN--------NNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSD--------------- 280
            :|.        ::....|...::.||   |...:...|.:.|....||:.               
  Fly   218 ISGAAAQTAAASSLHQASNHTFYPWM---AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSES 279

  Fly   281 -----LLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQ 340
                 |.|..|....:.:.|..||.:|.||||||:.|:.|:|.||:.|:|..|.|:|||:|||||
  Fly   280 LAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQ 344

  Fly   341 NRRAKERKQ 349
            |||.|.:|:
  Fly   345 NRRMKLKKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 31/51 (61%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.