DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and ems

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster


Alignment Length:457 Identity:98/457 - (21%)
Similarity:142/457 - (31%) Gaps:163/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPYTQKHSAANLAYASAAGQPWNWTPNYH-HTPPNHQFLGDVDSSHAAHHAAAAHQMY---YNSH 69
            |||...|          |.|.....|:.| |..|..|        |..|......|.:   ..||
  Fly    91 LPYPHPH----------AQQQHLQAPHPHPHLSPAQQ--------HVLHQHLLMQQQHPGTPKSH 137

  Fly    70 --------HMFHSAAAAS---------AGEWHSPASSTADNFVQNVPTSAHQLMQQHHH------ 111
                    .:.|:||.||         :.|...|..:.:   ::...:.|...|:|..:      
  Fly   138 QDIQELLQRLHHNAAMASGLSPLQTRLSPETEQPQMAVS---LKRERSPAPPAMEQAENPAQRIQ 199

  Fly   112 --HHAHASSSSASSGSSSS--------------------------------GGA-----PGAPQL 137
              |....|.|..||..|||                                |||     ||.|..
  Fly   200 PPHTPPKSVSPQSSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPA 264

  Fly   138 NETNS-SIGVGGAGGGGGVGGATD--------GGPGSAPPNHQQH-IAEGLPSPPITVSGSEISS 192
            ..... .:|.||.....|..|..|        ..|...||.|..| ||.........:....:..
  Fly   265 GLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLG 329

  Fly   193 PGAPTSASS--PHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSK------ 249
            |.|..:|::  |    .|....:.|.....::....|..         :|.:.|..|.:      
  Fly   330 PAAAAAAAAGLP----PHAAQFMPNPGMARDSYQLYPWL---------LSRHGRIFPHRFPGSFL 381

  Fly   250 -PPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTS 313
             ||:    :||                                .:.|..::..|.|:||..:.::
  Fly   382 VPPF----RKP--------------------------------KRIRTAFSPSQLLKLEHAFESN 410

  Fly   314 RYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK-------GSDPNVMGVGVQHADYSQL 371
            :|:....:..|||.|:|||.|||:||||||.|.::..::       ||..| |..|....|..:|
  Fly   411 QYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRN-MHNGSGDEDDDEL 474

  Fly   372 LD 373
            :|
  Fly   475 ID 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 23/51 (45%)
emsNP_731868.1 Homeobox 392..444 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
54.820

Return to query results.
Submit another query.