DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and ftz

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:385 Identity:100/385 - (25%)
Similarity:136/385 - (35%) Gaps:140/385 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 YYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPT-SAHQLMQQHHHHHAHASSSSASSGSSSS 128
            :|.:......|.|.|.....|||.|....:| .||| ||.:.:.     :....|..:.:....:
  Fly   127 FYTTVEQVKKAPAVSTKVTASPAPSYDQEYV-TVPTPSASEDVD-----YLDVYSPQSQTQKLKN 185

  Fly   129 GGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSP 193
            |.....|...                        |.|.||      .||:.:||        .||
  Fly   186 GDFATPPPTT------------------------PTSLPP------LEGISTPP--------QSP 212

  Fly   194 GAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKK 258
            |..:|            |||                      :..:::...|:|:....|:|   
  Fly   213 GEKSS------------SAV----------------------SQEINHRIVTAPNGAGDFNW--- 240

  Fly   259 PAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSE 323
                :..:..|:|           |.....||    |..||.:|.||||||:..:||||.||:.:
  Fly   241 ----SHIEETLAS-----------DCKDSKRT----RQTYTRYQTLELEKEFHFNRYITRRRRID 286

  Fly   324 LAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSL 388
            :|..|||||||:||||||||.|.:|.....|.|...|.|     |:.:|       |.|.     
  Fly   287 IANALSLSERQIKIWFQNRRMKSKKDRTLDSSPEHCGAG-----YTAML-------PPLE----- 334

  Fly   389 AHSMNPMAAMNIPAMRLHPH-----LAAHSHSLAAVAAHSH-----------QLQQQHSA 432
            |.|.....|.::|....|.|     ..|:|||      |||           |..||:.|
  Fly   335 ATSTATTGAPSVPVPMYHHHQTTAAYPAYSHS------HSHGYGLLNDYPQQQTHQQYDA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 33/51 (65%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 36/205 (18%)
Homeobox 257..310 CDD:278475 34/56 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.