DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Dfd

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:514 Identity:128/514 - (24%)
Similarity:185/514 - (35%) Gaps:164/514 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HYYNTLPYTQKHSAANLAYASAAGQ---------PWNWTPNYHHTPPNHQFLGDVDSSHAAHHAA 59
            |:||. .|:...|..:::.|...|.         ....|.:.|...|     .|:.|.:.|||  
  Fly    37 HHYNG-HYSMTASTGHMSGAVGGGAGVGSVGGGGAGGMTGHPHSMHP-----ADMVSDYMAHH-- 93

  Fly    60 AAHQMYYNSHHMFHS-----AAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSS 119
              |..:.:||...||     :.:|.:|...:.|...:.|:....|.|     ..|.|.|||...|
  Fly    94 --HNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANATPPS-----HPHSHPHAHPHQS 151

  Fly   120 SA----------SSGSSSSGGAPG-APQLNETNSSIGVGGAG-----GGGGVGGATDG------- 161
            ..          |:|:..|....| .|..|..|:|.|.||.|     |||.|||:.:|       
  Fly   152 LGYYVHHAPEFISAGAVHSDPTNGYGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGG 216

  Fly   162 ----GPGSAPPNHQQ-HIAEGLPSP-------PITVSGSEISSPGAPTSASSPHHHLAHHLSA-- 212
                ..||....|.| |      ||       |:..|.:|     .||:.:.....|...|..  
  Fly   217 GYGTANGSVGSTHSQGH------SPHSQMMDLPLQCSSTE-----PPTNTALGLQELGLKLEKRI 270

  Fly   213 ---------------------VANNNNNNNNN-----NNSPSTHNNNNNNNSVSNNN-------R 244
                                 :.:.|::.:..     :.||....:|:|::.:.:::       .
  Fly   271 EEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAE 335

  Fly   245 TSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKE 309
            |:..:...:.||||  .......:.|..|.:|              ..:.|..||..|.||||||
  Fly   336 TTDGERIIYPWMKK--IHVAGVANGSYQPGME--------------PKRQRTAYTRHQILELEKE 384

  Fly   310 YCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDA 374
            :..:||:|.||:.|:|.||.|||||:||||||||.|.:|.||..:..||.         .:.:||
  Fly   385 FHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPNTKNVR---------KKTVDA 440

  Fly   375 KAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAAVAAHSHQLQQQHSAQ 433
            ..                ||......|..|             |.:....|.|||..:|
  Fly   441 NG----------------NPTPVAKKPTKR-------------AASKKQQQAQQQQQSQ 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 33/51 (65%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.