DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and cdx1a

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:240 Identity:88/240 - (36%)
Similarity:99/240 - (41%) Gaps:102/240 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SGGAPG---APQLNETNSSIGVGGAGGGGGVGGATDGGPGSA---PPNHQQHIAEGLPSPPITVS 186
            ||..||   ...|:.|.||...|             .||||.   ||.:.......||:     :
Zfish    38 SGYHPGPALGNDLHHTGSSWSPG-------------FGPGSRDDWPPLYGHGTGHSLPA-----N 84

  Fly   187 GSEIS---------SPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNN 242
            |.|:|         ..|||.....|.                                       
Zfish    85 GVEVSVLPSVDQGLLSGAPVDREEPQ--------------------------------------- 110

  Fly   243 NRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELE 307
                       |||::.|.|..|                   .|||||||||||||:|.||||||
Zfish   111 -----------DWMRRSAVPTNP-------------------GGKTRTKDKYRVVYSDVQRLELE 145

  Fly   308 KEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            ||:..|||||||||:|||.||:|||||||||||||||||||.|||
Zfish   146 KEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERKMNKK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 27/144 (19%)
COG5576 <122..227 CDD:227863 59/88 (67%)
Homeobox 133..185 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579572
Domainoid 1 1.000 97 1.000 Domainoid score I7177
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm25485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24332
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.