DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and cdx4

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_989417.1 Gene:cdx4 / 395056 XenbaseID:XB-GENE-482787 Length:260 Species:Xenopus tropicalis


Alignment Length:278 Identity:96/278 - (34%)
Similarity:117/278 - (42%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SSSSASSGSSSSGGAPGAPQLNET--NSSIGVGGAGGGGGVGGATDGGP-------GSAPPNHQQ 172
            |..|||:..|:...|...|..|..  :....:...|...||.|...|.|       |:.|.|...
 Frog    20 SVRSASNNHSAQNYASNQPYFNYVTYHHVPPMDEQGQPCGVWGPQYGSPREQWNSYGAGPSNTNM 84

  Fly   173 HIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNN 237
            ..:..|.......:.|..||| .|:.....|.....|.:|            ||||..:.|:   
 Frog    85 AQSSDLSPNQFAYNSSGYSSP-HPSGTGILHSVDLSHTAA------------NSPSDLSQNS--- 133

  Fly   238 SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQ 302
                           ::||.|.....                    ::||||||:||||||||.|
 Frog   134 ---------------YEWMGKTVQST--------------------STGKTRTKEKYRVVYTDHQ 163

  Fly   303 RLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK--------------- 352
            |||||||:..|||||||||:|||.:|.|||||||||||||||||||..||               
 Frog   164 RLELEKEFHYSRYITIRRKTELAASLRLSERQVKIWFQNRRAKERKLFKKKMNQFDGICSVQSDS 228

  Fly   353 -GSDPNVMGVGVQHADYS 369
             .:.||.:...|.|.|.|
 Frog   229 SSASPNPLCDSVVHTDMS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
cdx4NP_989417.1 Caudal_act 16..139 CDD:282574 33/149 (22%)
Homeobox 156..208 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7188
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4705
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm47998
Panther 1 1.100 - - O PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.