DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and msx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_002936749.1 Gene:msx2 / 394987 XenbaseID:XB-GENE-852974 Length:256 Species:Xenopus tropicalis


Alignment Length:339 Identity:71/339 - (20%)
Similarity:110/339 - (32%) Gaps:150/339 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GEWHSPASSTADNF---VQNVPTSAHQLM-------QQHHHHHAHASSSSASSGSSSSG--GAPG 133
            |:.| |..|.:|:.   |.::|.|...||       :..|.....||::.::......|  .:|.
 Frog    17 GQVH-PTLSPSDDHKIKVSSLPFSVEALMADKRVPKEAPHLRGVDASAAGSTPRHLHMGIRDSPS 80

  Fly   134 APQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTS 198
            .|.|.:|..:..|.......|...:.|||..|.||.|.                           
 Frog    81 PPGLTKTFETSSVKSENSEDGTTWSKDGGSYSPPPRHL--------------------------- 118

  Fly   199 ASSPHHHLAHHLSAVANNNNNNNNNNNSPST-----HNNNNNNNSVSNNNRTSPSKPPYFDWMKK 258
                                       ||||     |..|                       :|
 Frog   119 ---------------------------SPSTCTLRKHKTN-----------------------RK 133

  Fly   259 PAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSE 323
            |..|                                   :|..|.|.||:::...:|::|..::|
 Frog   134 PRTP-----------------------------------FTTSQLLALERKFRQKQYLSIAERAE 163

  Fly   324 LAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQL-LDAKAKLEPGLHLSHS 387
            .:.:|:|:|.||||||||||||.::              :|.|:..:| :.||..|.||.    |
 Frog   164 FSSSLNLTETQVKIWFQNRRAKAKR--------------LQEAEIEKLKMAAKPILPPGF----S 210

  Fly   388 LAHSMN-PMAAMNI 400
            :...:| |:.|.::
 Frog   211 IPFPINSPIQAASL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 23/51 (45%)
msx2XP_002936749.1 Homeobox 134..188 CDD:365835 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.